| Identification |
|---|
| Name: | Curli assembly protein CsgC |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | csgC |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | periplasmic space |
|---|
| Specific Function: | Plays a role in the extracellular assembly of CsgA into thin aggregative fimbriae (Tafi) fibers. Assembly may also require CsgE. Tafi are thought to be assembled via an extracellular nucleation-precipitation (ENP) pathway, and possibly also via an intracellular non-CsgC-dependent pathway (By similarity). |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | Not Available |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| periplasmic space |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >333
atgaatacgttattactccttgcggcactttccagtcagataacctttaatacgacccag
caaggggatgtgtataccattattcctgaagtcactcttactcaatcttgtctgtgcaga
gtacaaatattgtccctgcgcgaaggcagttcagggcaaagtcagacgaagcaagaaaag
accctttcattgcctgctaatcaacccattgctttgacgaagttgagtttaaatatttcc
ccggacgatcgggtgaaaatagttgttactgtttctgatggacagtcacttcatttatca
caacaatggccgccctcttcagaaaagtcttaa |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 110 |
|---|
| Protein Molecular Weight: | 11966 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| Signaling Regions: | |
|---|
| Transmembrane Regions: | Not Available |
|---|
| Protein Sequence: | >Curli assembly protein CsgC
MNTLLLLAALSSQITFNTTQQGDVYTIIPEVTLTQSCLCRVQILSLREGSSGQSQTKQEK
TLSLPANQPIALTKLSLNISPDDRVKIVVTVSDGQSLHLSQQWPPSSEKS |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|
