Identification |
---|
Name: | Divisome-associated membrane protein Blr |
---|
Synonyms: | Not Available |
---|
Gene Name: | blr |
---|
Enzyme Class: | Not Available |
---|
Biological Properties |
---|
General Function: | response to antibiotic |
---|
Specific Function: | Component of the cell division machinery, which is probably involved in the stabilization of the divisome under certain stress conditions. |
---|
Cellular Location: | Not Available |
---|
SMPDB Pathways: | Not Available |
---|
KEGG Pathways: | Not Available |
---|
Metabolites: | |
---|
GO Classification: | Function |
---|
cell cycle | cell division | cell division site | cellular response to cell envelope stress | integral component of membrane | plasma membrane | response to antibiotic |
|
---|
Gene Properties |
---|
Blattner: | Not Available |
---|
Gene Orientation | Not Available |
---|
Centisome Percentage: | Not Available |
---|
Left Sequence End | Not Available |
---|
Right Sequence End | Not Available |
---|
Gene Sequence: | >126
atgaatcgtcttattgaattaacaggttggatcgttcttgtcgtttcagtcattcttctt
ggcgtggcgagtcacattgacaactatcagccacctgaacagagtgcttcggtacaacac
aagtaa |
---|
Protein Properties |
---|
Pfam Domain Function: | Not Available |
---|
Protein Residues: | 41 |
---|
Protein Molecular Weight: | 4556 |
---|
Protein Theoretical pI: | Not Available |
---|
Signaling Regions: | Not Available |
---|
Transmembrane Regions: | |
---|
Protein Sequence: | >Divisome-associated membrane protein Blr
MNRLIELTGWIVLVVSVILLGVASHIDNYQPPEQSASVQHK |
---|
References |
---|
External Links: | |
---|
General Reference: | Not Available |
---|