| Identification |
|---|
| Name: | Chaperone modulatory protein CbpM |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | cbpM |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | negative regulation of catalytic activity |
|---|
| Specific Function: | Interacts with CbpA and inhibits both the DnaJ-like co-chaperone activity and the DNA binding activity of CbpA. Together with CbpA, modulates the activity of the DnaK chaperone system. Does not inhibit the co-chaperone activity of DnaJ. |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | Not Available |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| enzyme inhibitor activity | | negative regulation of catalytic activity |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >306
atggctaatgttacggtgacttttactattaccgaattttgcctgcataccggcatctct
gaagaggagttgaatgaaattgtcggtttgggggtggttgaaccgcgtgagatccaggaa
acaacctgggtatttgacgaccatgccgccattgtggtgcaacgcgcggtacgcctgcgt
catgaactggctctggactggccggggatcgcggtggcgctgacgttaatggatgatatt
gcgcacctgaagcaggaaaaccgcctgctgcgccagcggctttcccggtttgtagctcat
ccgtga |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 101 |
|---|
| Protein Molecular Weight: | 11512 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | Not Available |
|---|
| Protein Sequence: | >Chaperone modulatory protein CbpM
MANVTVTFTITEFCLHTGISEEELNEIVGLGVVEPREIQETTWVFDDHAAIVVQRAVRLR
HELALDWPGIAVALTLMDDIAHLKQENRLLRQRLSRFVAHP |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|
