| Identification |
|---|
| Name: | OriC-binding nucleoid-associated protein |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | cnu |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | positive regulation of DNA-templated transcription, termination |
|---|
| Specific Function: | The complex formed with H-NS binds to the specific 26-bp cnb site in the origin of replication oriC. Can complement, at least partially, the absence of the Hha protein in hha mutants. |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | Not Available |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| DNA binding | | negative regulation of single-species biofilm formation on inanimate substrate | | positive regulation of DNA-templated transcription, termination |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >216
atgactgttcaggactacttattaaaatttcgcaaaatcagttcactcgaaagtctggaa
aaactctacgaccatcttaattacaccctgacggacgatcaggaactgatcaatatgtat
cgtgctgccgatcaccgtcgcgcagagctggtttctggcgggcgtttgtttgacctcggc
caggtaccgaagtccgtctggcactatgtccaataa |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 71 |
|---|
| Protein Molecular Weight: | 8416 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| PDB File: | 2JQT |
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | Not Available |
|---|
| Protein Sequence: | >OriC-binding nucleoid-associated protein
MTVQDYLLKFRKISSLESLEKLYDHLNYTLTDDQELINMYRAADHRRAELVSGGRLFDLG
QVPKSVWHYVQ |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|
