| Identification |
|---|
| Name: | Cytoskeleton-binding toxin CbtA |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | cbtA |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | regulation of cell shape |
|---|
| Specific Function: | Toxic component of a type IV toxin-antitoxin (TA) module. Interacts with cytoskeletal proteins FtsZ and MreB; inhibits FtsZ GTP-dependent polymerization and GTPase activity as well as MreB ATP-dependent polymerization. Binds to both the N- and C-terminus of FtsZ, likely blocking its polymerization. Overexpression results in inhibition of growth in liquid cultures and decrease in colony formation; these effects are overcome by concomitant expression of antitoxin CbeA (YeeU). In other experiments after 6 hours cells are lemon-shaped and by 24 hours those that have not lysed are spherical with diminished polar regions. Toxic effects are neutralized by cognate antitoxin CbeA, although there is no direct interaction between the 2 proteins. |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | Not Available |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| cytoskeletal protein binding | | programmed cell death | | regulation of cell shape |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >375
atgaaaacattacctgtattacccgggcaggcggccagttctcgcccgtctcctgttgaa
atctggcagatactgctgtcccgactgctggaccagcactatggcctcacactgaatgac
acaccttttgccgatgaacgtgtgattgagcagcatattgaggcaggcatttcactgtgt
gatgcggtgaactttctcgtggaaaaatacgcgctggtgcgtaccgaccagccgggattc
agcgcctgtacccgctctcagttaataaacagcatcgatatcctccgggctcgcagggcg
accggcctgatgacccgcgacaattacagaacggtaaataacattaccctgggtaagtat
ccggaggcgaaatga |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 124 |
|---|
| Protein Molecular Weight: | 13898 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | Not Available |
|---|
| Protein Sequence: | >Cytoskeleton-binding toxin CbtA
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLC
DAVNFLVEKYALVRTDQPGFSACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKY
PEAK |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|
