Identification |
---|
Name: | mRNA interferase HigB |
---|
Synonyms: | Not Available |
---|
Gene Name: | higB |
---|
Enzyme Class: | Not Available |
---|
Biological Properties |
---|
General Function: | RNA phosphodiester bond hydrolysis, endonucleolytic |
---|
Specific Function: | Toxic component of a toxin-antitoxin (TA) module. A probable translation-dependent mRNA interferase. Overexpression causes cessation of cell growth and inhibits cell proliferation via inhibition of translation; this blockage is overcome by subsequent expression of antitoxin HigA. Overexpression causes cleavage of a number of mRNAs in a translation-dependent fashion, suggesting this is an mRNA interferase. |
---|
Cellular Location: | Not Available |
---|
SMPDB Pathways: | Not Available |
---|
KEGG Pathways: | Not Available |
---|
Metabolites: | |
---|
GO Classification: | Function |
---|
endoribonuclease activity | negative regulation of translation | regulation of mRNA stability | RNA binding | RNA phosphodiester bond hydrolysis, endonucleolytic |
|
---|
Gene Properties |
---|
Blattner: | Not Available |
---|
Gene Orientation | Not Available |
---|
Centisome Percentage: | Not Available |
---|
Left Sequence End | Not Available |
---|
Right Sequence End | Not Available |
---|
Gene Sequence: | >315
atgcacctgataactcaaaaagcattgaaagatgctgcggaaaaatacccgcaacataaa
acggagttggtggctctggggaacacgattgctaagggatatttcaaaaaacctgagtca
ttaaaagcagtattcccatctctggataacttcaaatatctggataagcattatgttttc
aatgttgggggcaatgaattacgtgttgtagcaatggtcttttttgaatcgcaaaagtgc
tacatacgtgaagttatgacgcataaagaatacgatttctttaccgctgttcatcgtact
aaggggaaaaaatga |
---|
Protein Properties |
---|
Pfam Domain Function: | Not Available |
---|
Protein Residues: | 104 |
---|
Protein Molecular Weight: | 12103 |
---|
Protein Theoretical pI: | Not Available |
---|
Signaling Regions: | Not Available |
---|
Transmembrane Regions: | Not Available |
---|
Protein Sequence: | >mRNA interferase HigB
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVF
NVGGNELRVVAMVFFESQKCYIREVMTHKEYDFFTAVHRTKGKK |
---|
References |
---|
External Links: | |
---|
General Reference: | Not Available |
---|