Identification |
---|
Name: | Toxin YhaV |
---|
Synonyms: | Not Available |
---|
Gene Name: | yhaV |
---|
Enzyme Class: | Not Available |
---|
Biological Properties |
---|
General Function: | transcription, DNA-templated |
---|
Specific Function: | Toxic component of a toxin-antitoxin (TA) module. Has RNase activity in vitro. Overexpression leads to growth arrest after 30 minutes; these effects are overcome by concomitant expression of antitoxin SohA (PrlF). Massive overexpression is toxic. Unlike most other characterized TA systems degrades rRNA, and co-folding of the proteins is necessary in vitro for inhibition of the RNase activity. It is not known if it has any sequence-specificity. Acts as a transcription factor. The YhaV/PrlF complex binds the prlF-yhaV operon, probably negatively regulating its expression. |
---|
Cellular Location: | Not Available |
---|
SMPDB Pathways: | Not Available |
---|
KEGG Pathways: | Not Available |
---|
Metabolites: | |
---|
GO Classification: | Function |
---|
endoribonuclease activity | negative regulation of cell growth | negative regulation of transcription, DNA-templated | RNA phosphodiester bond hydrolysis, endonucleolytic | transcription, DNA-templated |
|
---|
Gene Properties |
---|
Blattner: | Not Available |
---|
Gene Orientation | Not Available |
---|
Centisome Percentage: | Not Available |
---|
Left Sequence End | Not Available |
---|
Right Sequence End | Not Available |
---|
Gene Sequence: | >465
atggattttccacaaagggttaatggttgggcgctatatgctcatccctgttttcaggaa
acctacgacgctttagttgccgaagtcgagacattaaagggaaaagatcctgaaaattat
cagagaaaagccgccacaaagttattggcggtagtccataaagtgattgaggagcatatc
acggtcaatccatcatcaccggcattccgtcatggcaagtcgttaggctctgggaaaaat
aaagactggtcacgggtaaaatttggtgctggtcgttatcgtctcttctttcgttatagt
gaaaaagagaaagtcatcattctgggatggatgaacgatgaaaacactctgcgcacctac
ggtaaaaaaacagatgcctataccgtattcagcaaaatgttaaaaagaggacatcctcct
gccgactgggaaaccctcacccgagaaacagaagaaacccattga |
---|
Protein Properties |
---|
Pfam Domain Function: | Not Available |
---|
Protein Residues: | 154 |
---|
Protein Molecular Weight: | 17836 |
---|
Protein Theoretical pI: | Not Available |
---|
Signaling Regions: | Not Available |
---|
Transmembrane Regions: | Not Available |
---|
Protein Sequence: | >Toxin YhaV
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHI
TVNPSSPAFRHGKSLGSGKNKDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTY
GKKTDAYTVFSKMLKRGHPPADWETLTRETEETH |
---|
References |
---|
External Links: | |
---|
General Reference: | Not Available |
---|