Identification |
---|
Name: | Toxin GhoT |
---|
Synonyms: | Not Available |
---|
Gene Name: | ghoT |
---|
Enzyme Class: | Not Available |
---|
Biological Properties |
---|
General Function: | cell death |
---|
Specific Function: | Toxic component of a type V toxin-antitoxin (TA) module. Causes membrane damage when induced by MqsR, slowing cell growth and increasing the formation of dormant persister cells; involved with GhoS, its antitoxin, in reducing cell growth during antibacterial stress (PubMed:24373067). Overexpression causes cell lysis, forming ghost cells; both effects are neutralized by expression of GhoS. Overexpression in the presence of ampicillin increases persister cell formation (persister cells exhibit antibiotic tolerance without genetic change) (PubMed:22941047). Overexpression causes about 90-fold reduction in cellular ATP levels and dissipates the membrane potential (PubMed:24373067). |
---|
Cellular Location: | Not Available |
---|
SMPDB Pathways: | Not Available |
---|
KEGG Pathways: | Not Available |
---|
Metabolites: | |
---|
GO Classification: | Function |
---|
cell death | cell pole | integral component of membrane | membrane | plasma membrane |
|
---|
Gene Properties |
---|
Blattner: | Not Available |
---|
Gene Orientation | Not Available |
---|
Centisome Percentage: | Not Available |
---|
Left Sequence End | Not Available |
---|
Right Sequence End | Not Available |
---|
Gene Sequence: | >174
atggcactattctctaaaatattaattttttatgtgattggtgtgaacatatcctttgtc
attatctggtttatctcacatgagaaaacacatattcgtttacttagtgcattcctggtc
ggaataacctggccaatgagtctgcctgtggcattacttttttctctcttttag |
---|
Protein Properties |
---|
Pfam Domain Function: | Not Available |
---|
Protein Residues: | 57 |
---|
Protein Molecular Weight: | 6554 |
---|
Protein Theoretical pI: | Not Available |
---|
Signaling Regions: | Not Available |
---|
Transmembrane Regions: | |
---|
Protein Sequence: | >Toxin GhoT
MALFSKILIFYVIGVNISFVIIWFISHEKTHIRLLSAFLVGITWPMSLPVALLFSLF |
---|
References |
---|
External Links: | |
---|
General Reference: | Not Available |
---|