| Identification |
|---|
| Name: | Antitoxin YefM |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | yefM |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | transcription, DNA-templated |
|---|
| Specific Function: | Antitoxin component of a toxin-antitoxin (TA) module. Antitoxin that counteracts the effect of the YoeB toxin. YefM binds to the promoter region of the yefM-yeoB operon to repress transcription, YeoB acts as a corepressor. |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | Not Available |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| negative regulation of transcription, DNA-templated | | sequence-specific DNA binding | | single-species biofilm formation | | toxic substance binding | | transcription, DNA-templated |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >252
atgcgtacaattagctacagcgaagcgcgtcagaatttgtcggcaacaatgatgaaagcc
gttgaagatcatgccccgatccttattactcgtcagaatggagaggcttgtgttctgatg
tcactcgaagaatacaactcgctggaagagacggcttatctactgcgctcccccgctaac
gcccggagattgatggactcaatcgatagcctgaaatcaggcaaaggaacggaaaaggac
atcattgagtga |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 83 |
|---|
| Protein Molecular Weight: | 9307 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| PDB File: | 2A6Q |
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | Not Available |
|---|
| Protein Sequence: | >Antitoxin YefM
MRTISYSEARQNLSATMMKAVEDHAPILITRQNGEACVLMSLEEYNSLEETAYLLRSPAN
ARRLMDSIDSLKSGKGTEKDIIE |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|
