| Identification |
|---|
| Name: | Toxin YoeB |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | yoeB |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | transcription, DNA-templated |
|---|
| Specific Function: | Toxic component of a toxin-antitoxin (TA) module. Its mode of function is controversial; it has been proposed to be an mRNA interferase but also an inhibitor of translation initiation. When overproduced in wild-type cells, inhibits bacterial growth and translation by cleavage of mRNA molecules while it has a weak effect on colony forming ability. Overproduction of Lon protease specifically activates YoeB-dependent mRNA cleavage, leading to lethality. YefM binds to the promoter region of the yefM-yeoB operon to repress transcription, YeoB acts as a corepressor.Shown in vitro to be an mRNA interferase that requires translation for substrate cleavage; if the mRNA is mutated so as to not be translatable it is no longer cleaved. Cleavage only occurs within translated regions. Has RNase activity and preferentially cleaves at the 3'-end of purine ribonucleotides.Also shown in vitro to be a translation initiation blocker. Binds to the 70S ribosome and 50S ribosomal subunit; binding is inhibited by hygromycin A and tetracycline, both of which bind to the 30S subunit in the A site. Thus YoeB is located at the interface between 50S and 30S ribosomes and interacts with the A site where it cleaves mRNA, blocking translation initiation. |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | Not Available |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| endoribonuclease activity | | endoribonuclease activity, producing 3'-phosphomonoesters | | mRNA catabolic process | | mRNA cleavage | | negative regulation of nucleic acid-templated transcription | | negative regulation of translational initiation | | regulation of transcription, DNA-templated | | ribosomal small subunit binding | | RNA binding | | RNA phosphodiester bond hydrolysis, endonucleolytic | | single-species biofilm formation | | transcription corepressor activity | | transcription, DNA-templated |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >255
gtgaaactaatctggtctgaggaatcatgggacgattatctgtactggcaggaaacagat
aagcgaattgttaaaaagatcaatgaacttatcaaagatacccgcagaacgccatttgaa
ggtaaggggaagccagaacccctgaaacataatttgtcaggtttctggtcccgacgcatt
acagaggagcaccgtctggtatacgcggttaccgacgattcactgctcattgcagcatgt
cgttatcattattga |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 84 |
|---|
| Protein Molecular Weight: | 10215 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| PDB File: | 2A6Q |
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | Not Available |
|---|
| Protein Sequence: | >Toxin YoeB
MKLIWSEESWDDYLYWQETDKRIVKKINELIKDTRRTPFEGKGKPEPLKHNLSGFWSRRI
TEEHRLVYAVTDDSLLIAACRYHY |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|
