Identification |
---|
Name: | Anti-adapter protein IraM |
---|
Synonyms: | Not Available |
---|
Gene Name: | iraM |
---|
Enzyme Class: | Not Available |
---|
Biological Properties |
---|
General Function: | positive regulation of transcription, DNA-templated |
---|
Specific Function: | Inhibits RpoS proteolysis by regulating RssB activity, thereby increasing the stability of the sigma stress factor RpoS during magnesium starvation. May also be involved in the early steps of isoprenoid biosynthesis, possibly through its role as RssB regulator. |
---|
Cellular Location: | Not Available |
---|
SMPDB Pathways: | Not Available |
---|
KEGG Pathways: | Not Available |
---|
Metabolites: | |
---|
GO Classification: | Function |
---|
anti-sigma factor antagonist activity | cellular response to acidic pH | cellular response to magnesium starvation | cytoplasm | negative regulation of protein catabolic process | positive regulation of transcription, DNA-templated |
|
---|
Gene Properties |
---|
Blattner: | Not Available |
---|
Gene Orientation | Not Available |
---|
Centisome Percentage: | Not Available |
---|
Left Sequence End | Not Available |
---|
Right Sequence End | Not Available |
---|
Gene Sequence: | >324
atgaagtggatagtaattgacacggtaattcaacctacatgtggtatatctttttcagcc
atatggggtaatatgaaaatgatcatctggtatcaatctactatatttctccctcctggc
agtatatttacaccggttaagtctggtattatccttaaggataaagaatatcctattact
atttatcacatcgcaccattcaacaaggatttatggagtttactcaaaagcagtcaagag
tgtcctccaggagaaagcaaaataacaaataaatgtttacataatagttgcattataaaa
atatgcccatatgggctcaagtaa |
---|
Protein Properties |
---|
Pfam Domain Function: | Not Available |
---|
Protein Residues: | 107 |
---|
Protein Molecular Weight: | 12133 |
---|
Protein Theoretical pI: | Not Available |
---|
Signaling Regions: | Not Available |
---|
Transmembrane Regions: | Not Available |
---|
Protein Sequence: | >Anti-adapter protein IraM
MKWIVIDTVIQPTCGISFSAIWGNMKMIIWYQSTIFLPPGSIFTPVKSGIILKDKEYPIT
IYHIAPFNKDLWSLLKSSQECPPGESKITNKCLHNSCIIKICPYGLK |
---|
References |
---|
External Links: | |
---|
General Reference: | Not Available |
---|