| Identification |
|---|
| Name: | Probable two-component-system connector protein AriR |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | ariR |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | response to hydrogen peroxide |
|---|
| Specific Function: | Probably a connector protein for RcsB/C regulation of biofilm and acid-resistance, providing additional signal input into the two-component signaling pathway. May serve to stimulate biofilm maturation, via the Rcs phosphorelay. Regulates expression of genes involved in acid-resistance and biofilm formation, including the RcsB/C two-component system. May be a non-specific DNA-binding protein that binds genes and/or intergenic regions via a geometric recognition. Also confers resistance to H(2)O(2). Overexpression at 28 and 16 degrees Celsius increases the production of colanic acid, an exopolysaccharide and matrix component, and reduces adhesive curli fimbriae expression. Both of these effects require RcsB; AriR probably acts upstream of the RcsB/C system to stimulate the activity and not transcription of RcsB/C. 5-fluorouracil reduction in biofilm formation requires this protein. |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | Not Available |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| cellular response to acid chemical | | DNA binding | | response to hydrogen peroxide |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >267
atgcttgaagatactacaattcataatgcaataactgataaagcgttagcaagttacttt
cgcagttcgggtaatttgttagaagaagaatcagcagtgttagggcaggctgtcaccaat
ttaatgctttcaggcgataatgttaataataaaaatattatcttaagtctgatacactcc
ttggaaacaacaagtgatattctcaaagctgatgtgattagaaaaacactggaaatcgtg
ttgcgatacacagctgatgatatgtaa |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 88 |
|---|
| Protein Molecular Weight: | 9693 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| PDB File: | 2OXL |
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | Not Available |
|---|
| Protein Sequence: | >Probable two-component-system connector protein AriR
MLEDTTIHNAITDKALASYFRSSGNLLEEESAVLGQAVTNLMLSGDNVNNKNIILSLIHS
LETTSDILKADVIRKTLEIVLRYTADDM |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|
