| Identification |
|---|
| Name: | Cytoskeleton bundling-enhancing protein CbeA |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | cbeA |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | positive regulation of cytoskeleton organization |
|---|
| Specific Function: | Antitoxin component of a type IV toxin-antitoxin (TA) module. Labile antitoxin that counteracts the effect of its cognate toxin CbtA (YeeV). It does not bind to the toxin but instead binds to MreB and FtsZ (the toxin targets), enhancing their polymerization by forming higher-order bundles; it is probably retained in the MreB and FtsZ filament bundles. The mechanism has been proposed to require intergenic DNA, in cis, between the cbeA (yeeU) and cbta (yeeV) genes (PubMed:14594833). The intergenic region was not found to be necessary in another study (PubMed:22515815). Also counteracts the morphological defects caused by overexpression of SulA and DicB on cell shape. |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | Not Available |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| cytoplasm | | cytoskeletal protein binding | | metal ion binding | | positive regulation of cytoskeleton organization |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >369
gtgtcagacacactccccgggacaacacttcccgacgacaatcacgaccgcccctggtgg
gggctgccctgcaccgtgacgccctgtttcggggcacgtctggtgcaggagggtaaccgg
ttgcattaccttgccgaccgcgccggtatcagaggcctgttcagcgatgcagatgcgtac
cacctggaccaggcctttccgctgctgatgaaacaactggaactcatgctcaccagcggt
gaactgaatccccgccatcagcataccgtcacgctgtatgcaaaagggctgacctgcaaa
gccgataccctcagcagttgtgattacgtttatctggctgtttatccgacgcccgaaatg
aaaaattaa |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 122 |
|---|
| Protein Molecular Weight: | 13683 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| PDB File: | 2H28 |
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | Not Available |
|---|
| Protein Sequence: | >Cytoskeleton bundling-enhancing protein CbeA
MSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAY
HLDQAFPLLMKQLELMLTSGELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEM
KN |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|
