| Identification |
|---|
| Name: | CRISPR system Cascade subunit CasB |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | casB |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | defense response to virus |
|---|
| Specific Function: | CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain sequences complementary to antecedent mobile elements and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA).A component of Cascade, which participates in CRISPR interference, the third stage of CRISPR immunity. Cascade binds both crRNA and in a sequence-specific manner negatively supercoiled dsDNA target. This leads to the formation of an R-loop in which the crRNA binds the target DNA, displacing the noncomplementary strand. Cas3 is recruited to Cascade, nicks target DNA and then unwinds and cleaves the target, leading to DNA degradation and invader neutralization. |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | Not Available |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| defense response to virus | | protein complex | | RNA binding |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >483
atggctgatgaaattgatgcaatggctttatatcgagcctggcaacaactggataatgga
tcatgtgcgcaaattagacgtgtttcagaacctgatgaattacgcgatatccctgcgttt
tataggctggtgcaaccttttggttgggaaaacccacgtcaccagcaggctcttttgcgc
atggtgttttgcctgagcgcaggaaagaatgtcatccgacatcaggacaaaaaatcggag
caaacaacaggtatctcgttgggaagagctttagccaatagtggaagaattaacgagcgc
cgtatctttcaattaattcgggctgacagaacagccgatatggtccagttacgtcgatta
cttactcacgccgaacccgtacttgactggccattaatggccaggatgttgacctggtgg
ggaaagcgcgaacgccagcaacttctggaagattttgtattgaccacaaacaaaaatgcg
taa |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 160 |
|---|
| Protein Molecular Weight: | 18701 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| PDB File: | 4QYZ |
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | Not Available |
|---|
| Protein Sequence: | >CRISPR system Cascade subunit CasB
MADEIDAMALYRAWQQLDNGSCAQIRRVSEPDELRDIPAFYRLVQPFGWENPRHQQALLR
MVFCLSAGKNVIRHQDKKSEQTTGISLGRALANSGRINERRIFQLIRADRTADMVQLRRL
LTHAEPVLDWPLMARMLTWWGKRERQQLLEDFVLTTNKNA |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|
