Identification |
---|
Name: | Ferredoxin-like protein YdiT |
---|
Synonyms: | Not Available |
---|
Gene Name: | ydiT |
---|
Enzyme Class: | Not Available |
---|
Biological Properties |
---|
General Function: | oxidation-reduction process |
---|
Specific Function: | Could be a 3Fe-4S cluster-containing protein. Probably participates in a redox process with YdiQ, YdiR and YdiS. |
---|
Cellular Location: | Not Available |
---|
SMPDB Pathways: | Not Available |
---|
KEGG Pathways: | Not Available |
---|
Metabolites: | |
---|
GO Classification: | Function |
---|
iron ion binding | iron-sulfur cluster binding | oxidation-reduction process |
|
---|
Gene Properties |
---|
Blattner: | Not Available |
---|
Gene Orientation | Not Available |
---|
Centisome Percentage: | Not Available |
---|
Left Sequence End | Not Available |
---|
Right Sequence End | Not Available |
---|
Gene Sequence: | >294
atgagccagaacgctacggttaacgtcgacatcaaattaggcgtcaataaattccatgtt
gatgagggccacccgcatatcattctggcggaaaatcccgatatcaatgaattccataaa
ttaatgaaagcctgccctgccggactttataagcaggatgacgcaggaaacattcatttt
gattccgccggttgtctggagtgcggcacctgtcgggtgctgtgcggtaacactattctc
gaacagtggcaatatcccgcaggcaccttcggtattgattttcgctacggctaa |
---|
Protein Properties |
---|
Pfam Domain Function: | Not Available |
---|
Protein Residues: | 97 |
---|
Protein Molecular Weight: | 10724 |
---|
Protein Theoretical pI: | Not Available |
---|
Signaling Regions: | Not Available |
---|
Transmembrane Regions: | Not Available |
---|
Protein Sequence: | >Ferredoxin-like protein YdiT
MSQNATVNVDIKLGVNKFHVDEGHPHIILAENPDINEFHKLMKACPAGLYKQDDAGNIHF
DSAGCLECGTCRVLCGNTILEQWQYPAGTFGIDFRYG |
---|
References |
---|
External Links: | |
---|
General Reference: | Not Available |
---|