| Identification |
|---|
| Name: | Response regulator inhibitor for tor operon |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | torI |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | transcription, DNA-templated |
|---|
| Specific Function: | Transcription inhibitory protein for the torCAD operon. Also acts as an excisionase and plays an essential role in the defective prophage CPS53 excision. |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | Not Available |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| DNA binding | | DNA excision | | DNA recombination | | negative regulation of DNA-templated transcription, initiation | | transcription, DNA-templated |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >201
atgcaacacgaactacagcctgattcactggttgatttgaaattcatcatggctgatact
ggctttggtaaaaccttcatctatgaccggattaagtcaggcgacctgccaaaagccaaa
gttatccacgggcgagcaagatggttatatcgtgaccattgtgaattcaaaaataagctc
ttaagccgcgccaatgggtaa |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 66 |
|---|
| Protein Molecular Weight: | 7677 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| PDB File: | 1Z4H |
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | Not Available |
|---|
| Protein Sequence: | >Response regulator inhibitor for tor operon
MQHELQPDSLVDLKFIMADTGFGKTFIYDRIKSGDLPKAKVIHGRARWLYRDHCEFKNKL
LSRANG |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|
