| Identification |
|---|
| Name: | CRISPR system Cascade subunit CasE |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | casE |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | RNA processing |
|---|
| Specific Function: | CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain sequences complementary to antecedent mobile elements and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA).CasE is required to process the pre-crRNA into single repeat-spacer units, with an 8-nt 5'-repeat DNA tag that may help other proteins recognize the crRNA. This subunit alone will cleave pre-crRNA, as will CasCDE or CasCE; cleavage does not require divalent metals or ATP. CasCDE alone is also able to form R-loops. Partially inhibits the cleavage of Holliday junctions by YgbT (Cas1). Yields a 5'-hydroxy group and a 2',3'-cyclic phosphate terminus.A component of Cascade, which participates in CRISPR interference, the third stage of CRISPR immunity. Cascade binds both crRNA and in a sequence-specific manner negatively supercoiled dsDNA target. This leads to the formation of an R-loop in which the crRNA binds the target DNA, displacing the noncomplementary strand. Cas3 is recruited to Cascade, nicks target DNA and then unwinds and cleaves the target, leading to DNA degradation and invader neutralization. |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | Not Available |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| defense response to virus | | endonuclease activity | | hydrolase activity | | protein complex | | RNA binding | | RNA processing |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >600
atgtatctcagtaaagtcatcattgccagggcctggagcagggatctttaccaacttcac
cagggattatggcatttatttccaaacagaccggatgctgctcgtgattttctttttcat
gttgagaagcgaaacacaccagaaggctgtcatgttttattgcagtcagcgcaaatgcct
gtttcaactgccgttgcgacagtcattaaaactaaacaggttgaatttcaacttcaggtt
ggtgttccactctattttcggcttcgggcaaatccgatcaaaactattctcgacaatcaa
aagcgcctggacagtaaagggaatattaaacgctgtcgggttccgttaataaaagaagca
gaacaaatcgcgtggttgcaacgtaaattgggcaatgcggcgcgcgttgaagatgtgcat
cccatatcggaacggccacagtatttttctggtgatggtaaaagtggaaagatccaaacg
gtttgctttgaaggtgtgctcaccatcaacgacgcgccagcgttaatagatcttgtacag
caaggtattgggccagctaaatcgatgggatgtggcttgctatctttggctccactgtga
|
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 199 |
|---|
| Protein Molecular Weight: | 22292 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| PDB File: | 4DZD |
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | Not Available |
|---|
| Protein Sequence: | >CRISPR system Cascade subunit CasE
MYLSKVIIARAWSRDLYQLHQGLWHLFPNRPDAARDFLFHVEKRNTPEGCHVLLQSAQMP
VSTAVATVIKTKQVEFQLQVGVPLYFRLRANPIKTILDNQKRLDSKGNIKRCRVPLIKEA
EQIAWLQRKLGNAARVEDVHPISERPQYFSGDGKSGKIQTVCFEGVLTINDAPALIDLVQ
QGIGPAKSMGCGLLSLAPL |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|
