Identification |
---|
Name: | Probable protein deglycase |
---|
Synonyms: | Not Available |
---|
Gene Name: | yajL |
---|
Enzyme Class: | Not Available |
---|
Biological Properties |
---|
General Function: | ribosome biogenesis |
---|
Specific Function: | Protein deglycase that repairs methylglyoxal- and glyoxal-glycated amino acids and proteins, and releases repaired proteins and lactate or glycolate, respectively. Deglycates cysteines, arginines and lysines residues in proteins, and thus reactivates these proteins by reversing glycation by glyoxals. Acts on early glycation intermediates (hemithioacetals and aminocarbinols), preventing the formation of advanced glycation endproducts (AGE) (PubMed:25416785) (By similarity). Displays a covalent chaperone activity with sulfenylated thiol proteins by forming mixed disulfides with members of the thiol proteome, and preferentially with sulfenylated cellular proteins, upon oxidative stress; these mixed disulfides can be subsequently reduced by low-molecular-weight thiols to regenerate YajL and reduced proteins (PubMed:22157000, PubMed:22321799). Involved in biogenesis of ribosomal proteins, probably as a ribosomal protein-folding chaperone. Confers resistance to oxidative stress. The chaperone activity reported for YajL is probably recruited to execute its deglycase activity, to interact with non-native glycated proteins and gain access to partially buried glycated sites. |
---|
Cellular Location: | Not Available |
---|
SMPDB Pathways: | Not Available |
---|
KEGG Pathways: | Not Available |
---|
Metabolites: | |
---|
GO Classification: | Function |
---|
cellular response to oxidative stress | hydrolase activity | protein refolding | response to heat | ribosome biogenesis |
|
---|
Gene Properties |
---|
Blattner: | Not Available |
---|
Gene Orientation | Not Available |
---|
Centisome Percentage: | Not Available |
---|
Left Sequence End | Not Available |
---|
Right Sequence End | Not Available |
---|
Gene Sequence: | >591
atgagcgcatcggcactggtttgcctcgcccctggtagtgaagagactgaagccgtcacc
actatcgatctgctggttcgcggcggtatcaaagtcaccactgccagcgtcgccagcgat
ggtaacctggcgattacctgctcgcgcggcgtgaagctgctggcggatgcgccgctggtc
gaagtggctgatggcgaatatgacgtgatcgtgctgcctggtggcattaaaggcgcggag
tgttttcgcgatagcactctgctggttgaaaccgttaaacagttccaccgttccgggcgt
atcgtcgcggctatttgcgccgcgccagccaccgtgctggtgccgcacgatatcttcccg
attggtaatatgaccggcttcccgacgctgaaagacaaaattcccgccgaacaatggctg
gacaagcgcgtcgtctgggatgcacgggtaaaattgctgaccagccaggggccgggtaca
gctatcgactttggtctgaaaattatcgacctgttggttgggcgtgaaaaagcccatgaa
gtggcatcacaactggtgatggcggcagggatttataattattacgagtag |
---|
Protein Properties |
---|
Pfam Domain Function: | Not Available |
---|
Protein Residues: | 196 |
---|
Protein Molecular Weight: | 20776 |
---|
Protein Theoretical pI: | Not Available |
---|
PDB File: | 2AB0 |
Signaling Regions: | Not Available |
---|
Transmembrane Regions: | Not Available |
---|
Protein Sequence: | >Probable protein deglycase
MSASALVCLAPGSEETEAVTTIDLLVRGGIKVTTASVASDGNLAITCSRGVKLLADAPLV
EVADGEYDVIVLPGGIKGAECFRDSTLLVETVKQFHRSGRIVAAICAAPATVLVPHDIFP
IGNMTGFPTLKDKIPAEQWLDKRVVWDARVKLLTSQGPGTAIDFGLKIIDLLVGREKAHE
VASQLVMAAGIYNYYE |
---|
References |
---|
External Links: | |
---|
General Reference: | Not Available |
---|