Identification |
---|
Name: | Antitoxin DinJ |
---|
Synonyms: | Not Available |
---|
Gene Name: | dinJ |
---|
Enzyme Class: | Not Available |
---|
Biological Properties |
---|
General Function: | transcription, DNA-templated |
---|
Specific Function: | Antitoxin component of a toxin-antitoxin (TA) module. A labile antitoxin that counteracts the effect of the YafQ toxin. YafQ and DinJ together bind their own promoter, and by analogy to other TA modules probably repress its expression.Cell death governed by the MazE-MazF and DinJ-YafQ TA modules seems to play a role in biofilm formation. |
---|
Cellular Location: | Not Available |
---|
SMPDB Pathways: | Not Available |
---|
KEGG Pathways: | Not Available |
---|
Metabolites: | |
---|
GO Classification: | Function |
---|
bacterial-type RNA polymerase core promoter proximal region sequence-specific DNA binding | negative regulation of DNA-templated transcription, initiation | single-species biofilm formation | toxic substance binding | transcription, DNA-templated |
|
---|
Gene Properties |
---|
Blattner: | Not Available |
---|
Gene Orientation | Not Available |
---|
Centisome Percentage: | Not Available |
---|
Left Sequence End | Not Available |
---|
Right Sequence End | Not Available |
---|
Gene Sequence: | >261
atggctgctaacgcgtttgttcgcgcccgaatcgatgaagatctgaagaatcaggcagcg
gacgtactggccgggatggggctgaccatctctgacctggttcgcataaccctcacaaag
gtcgcgcgtgaaaaggcattgccgtttgatttacgcgagcctaatcaattaaccattcaa
tcaatcaaaaacagcgaagctggcattgatgttcataaggccaaagacgccgatgattta
tttgataaattaggaatttaa |
---|
Protein Properties |
---|
Pfam Domain Function: | Not Available |
---|
Protein Residues: | 86 |
---|
Protein Molecular Weight: | 9405 |
---|
Protein Theoretical pI: | Not Available |
---|
PDB File: | 4Q2U |
Signaling Regions: | Not Available |
---|
Transmembrane Regions: | Not Available |
---|
Protein Sequence: | >Antitoxin DinJ
MAANAFVRARIDEDLKNQAADVLAGMGLTISDLVRITLTKVAREKALPFDLREPNQLTIQ
SIKNSEAGIDVHKAKDADDLFDKLGI |
---|
References |
---|
External Links: | |
---|
General Reference: | Not Available |
---|